Everyone has one....

If it doesn't fit .. It fits here .. - -

Everyone has one....

Postby Romulus111VADT » Wed Aug 27, 2008 3:01 pm

A word you simply cannot pronounce properly. To this day I have a devil of a time saying, "Apothecary". Even in grade school, I could spell it just fine, but I'd get all tongue tied and just couldn't get the word out of my mouth. It was very frustrating.

So what word (s) stumps your ability to pronounce it?
Former member
Romulus111VADT
Major
Major
 
Posts: 4898
Joined: Thu May 02, 2002 7:48 am

Re: Everyone has one....

Postby BFMF » Wed Aug 27, 2008 3:08 pm

If there are words that I have trouble pronouncing, I must not say them often enough to remember what they are...
BFMF
Colonel
Colonel
 
Posts: 16266
Joined: Mon Feb 25, 2002 6:06 pm
Location: Pacific Northwest

Re: Everyone has one....

Postby Sir_Crashalot » Wed Aug 27, 2008 3:12 pm

Try to pronounce this and you'll never bother again:

The name of the city of Bangkok in the Thai language:

Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthaniburiromudomrajniwesmahasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit

Enjoy,

Crash ;)
Sir_Crashalot
 

Re: Everyone has one....

Postby Romulus111VADT » Wed Aug 27, 2008 3:21 pm

Try to pronounce this and you'll never bother again:

The name of the city of Bangkok in the Thai language:

Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthaniburiromudomrajniwesmahasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit

Enjoy,

Crash ;)


Heck, I had to watch Mary Poppins a dozen times to get Supercalifragilisticexpialidocious down pat. I'm not gonna try that one. I might sprain something important....lmao.
Former member
Romulus111VADT
Major
Major
 
Posts: 4898
Joined: Thu May 02, 2002 7:48 am

Re: Everyone has one....

Postby aussiewannabe » Wed Aug 27, 2008 4:03 pm

Try this one:

Taumatawhakatangihangak oauauotamateaturipukaka pikimaungahoronukupokaiwhe nua kitanatahu

The M
HP Media Center Photosmart m7260n | 3.0GHz Intel Pentium D 830 | 2 GB RAM | 320 GB HD | Sapphire X1950 GT 512MB | Silencer 610 Watt PSU

[center][img]
http://www.simviation.com/yabbuploads/aussie_sig1.jpg
User avatar
aussiewannabe
Major
Major
 
Posts: 2528
Joined: Thu May 17, 2007 11:33 am

Re: Everyone has one....

Postby Wii » Wed Aug 27, 2008 4:08 pm

http://answers.yahoo.com/question/index?qid=20061113221628AAxlNn5
Also known as "Titin"

I find that one isn't hard to pronounce but takes a while...

This one is also hard.
methionylglutaminylarginyltyrosylglutamylserylleuc ylphenylalanylalanylglutaminylleucyll
ysylglutamylarginyllysylglutamylglycylalanylphenyl alanylvalylprolylphenylalanylvalylthre
onylleucylglycylaspartylprolylglycylisoleucylgluta mylglutaminylserylleucyllysylisoleucylas
partylthreonylleucylisoleucylglutamylalanylglycyla lanylaspartylalanylleucylglutamylleuc
ylglycylisoleucylprolylphenylalanylserylaspartylpr olylleucylalanylaspartylglycylprolylthreo
nylisoleucylglutaminylaspfraginylalanylthreonylleu cylarginylalanylphenylalanylalanylala
nylglycylvalylthreonylprolylalanylglutaminylcystei nylphenylalanylglutamylmethionylleuc
ylalanylleucylisoleucylarginylglutaminyllysylhisti dylprolylthreonylisoleucylprolylisoleucylg
lycylleucylleucylmethionyltyrosylalanylasparaginyl leucylvalylphenylalanylasparaginyllysy
lglycylisoleucylaspartylglutamylphenylalanyltyrosy lalanylglutaminylcysteinylglutamyllysyl
valylglycylvalylaspartylserylvalylleucylvalylalany laspartylvalylprolylvalylglutaminylglutam
ylserylalanylprolylphenylalanylarginylglutaminylal anylalanylleucylarginylhistidylasparagi
nylvalylalanylprolylisoleucylphenylalanylisoleucyl cysteinylprolylprolylaspartylalanylaspar
tylaspartylaspartylleucylleucylarginylglutaminylis oleucylalanylseryltyrosylglycylarginylglyc
yltyrosylthreonyltyrosylleucylleucylserylarginylal anylglycylvalylthreonylglycylalanylglutam
ylasparaginylarginylalanylalanylleucylprolylleucyl asparaginylhistidylleucylvalylalanyllysyl
leucyllysylglutamyltyrosylasparaginylalanylalanylp rolylprolylleucylglutaminylglycylphenyl
alanylglycylisoleucylserylalanylprolylaspartylglut aminylvalyllysylalanylalanylisoleucylaspa
rtylalanylglycylalanylalanylglycylalanylisoleucyls erylglycylserylalanylisoleucylvalyllysylisol
eucylisoleucylglutamylglutaminylhistidylasparaginy lisoleucylglutamylprolylglutamyllysylm
ethionylleucylalanylalanylleucyllysylvalylphenylal anylvalylglutaminylprolylmethionyllysyl
alanylalanylthreonylarginylserine.

Now say it ten times fast... ;D

Don't forget the world's largest domain name ::)
http://www.llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch.com/
Last edited by Wii on Wed Aug 27, 2008 4:15 pm, edited 1 time in total.
User avatar
Wii
Major
Major
 
Posts: 2727
Joined: Wed Jun 13, 2007 2:33 pm
Location: Space

Re: Everyone has one....

Postby Romulus111VADT » Wed Aug 27, 2008 4:20 pm

Man, I'd bust a giblet trying to pronounce any of those....lmao.

Heck, I'd have my tongue wrapped around my eye teeth and I'd never be able to see what I was saying..... ;)

I was sort of getting at more common words that stump people.
Last edited by Romulus111VADT on Wed Aug 27, 2008 4:21 pm, edited 1 time in total.
Former member
Romulus111VADT
Major
Major
 
Posts: 4898
Joined: Thu May 02, 2002 7:48 am

Re: Everyone has one....

Postby BigTruck » Wed Aug 27, 2008 4:49 pm

I'm gonna have to come back to this one, there are plenty of them but when I try to think of one, nothing happens
Alienware X51_R2 (thank you wife) Windows 8.1, 6GB Ram, Intel Core i3-4150 CPU @3.50GHz
FSX Acceleration settings on max, no twitches or glitches.
Saitek X52 Stick and Throttle
User avatar
BigTruck
Global Moderator
Global Moderator
 
Posts: 7048
Joined: Wed Jun 20, 2007 2:35 pm
Location: Tuscaloosa, AL

Re: Everyone has one....

Postby MWISimmer » Wed Aug 27, 2008 5:26 pm

I'd like to think I have a pretty decent command of the English language, however my Nan is a constant source of amusement when it comes to pronunciation..

Deodorant= Derodeant
Spaghetti = Pasghetti
Video Recorder = Veedo recorder

I have a few more which I can't think of now, and some I can think of which are too rude for a family forum...  :o  ;D
MWISimmer
 

Re: Everyone has one....

Postby expat » Wed Aug 27, 2008 5:30 pm

The guys I work with, for me would say any word in the German language ;D

Matt
Last edited by expat on Wed Aug 27, 2008 8:52 pm, edited 1 time in total.
"A bit of a pickle" - British translation: A catastrophically bad situation with potentially fatal consequences.

PETA Image People Eating Tasty Animals.

B1 (Cat C) licenced engineer, Boeing 737NG 600/700/800/900 Airbus A318/19/20/21 and Dash8 Q-400
1. Captain, if the problem is not entered into the technical logbook.........then the aircraft does not have a problem.
2. And, if you have time to write the fault on a napkin and attach to it to the yoke.........you have time to write it in the tech log....see point 1.
User avatar
expat
Lieutenant Colonel
Lieutenant Colonel
 
Posts: 8679
Joined: Tue Apr 19, 2005 3:06 am
Location: Deep behind enemy lines....

Re: Everyone has one....

Postby Wii » Wed Aug 27, 2008 5:40 pm

[quote]Man, I'd bust a giblet trying to pronounce any of those....lmao.

Heck, I'd have my tongue wrapped around my eye teeth and I'd never be able to see what I was saying..... ;)

I was sort of getting at more common words that stump people.
User avatar
Wii
Major
Major
 
Posts: 2727
Joined: Wed Jun 13, 2007 2:33 pm
Location: Space

Re: Everyone has one....

Postby Ravang » Wed Aug 27, 2008 6:36 pm

Man, I'd bust a giblet trying to pronounce any of those....lmao.

I tried to and look what happened...
Image

:P
User avatar
Ravang
Ground hog
Ground hog
 
Posts: 0
Joined: Sat Nov 07, 2009 11:40 pm
Location: South Carolina, USA

Re: Everyone has one....

Postby Romulus111VADT » Wed Aug 27, 2008 7:36 pm

Man, I'd bust a giblet trying to pronounce any of those....lmao.

I tried to and look what happened...
Image

:P


Wow, looks like that might of hurt..... ;)

Try a chiropractor.... :-/.....maybe the rack-

Image

That might pull you back out straight..... ;)

:)
Former member
Romulus111VADT
Major
Major
 
Posts: 4898
Joined: Thu May 02, 2002 7:48 am

Re: Everyone has one....

Postby Triple_7 » Wed Aug 27, 2008 9:07 pm

Most words with ING at the end...its all in the dialect around here, leaves off a lot of G's :P
Last edited by Triple_7 on Wed Aug 27, 2008 9:11 pm, edited 1 time in total.
Triple_7
 

Re: Everyone has one....

Postby H » Thu Aug 28, 2008 5:20 am

[quote]Another I just thought of, but its not so much pronouncing it as much as just combining to words.
H
Lieutenant Colonel
Lieutenant Colonel
 
Posts: 5525
Joined: Fri May 27, 2005 1:27 am
Location: NH, USA

Next

Return to General Discussion

Who is online

Users browsing this forum: No registered users and 265 guests