Simviation Forums

A word you simply cannot pronounce properly. To this day I have a devil of a time saying, "Apothecary". Even in grade school, I could spell it just fine, but I'd get all tongue tied and just couldn't get the word out of my mouth. It was very frustrating.

So what word (s) stumps your ability to pronounce it?

If there are words that I have trouble pronouncing, I must not say them often enough to remember what they are...

Try to pronounce this and you'll never bother again:

The name of the city of Bangkok in the Thai language:

Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthaniburiromudomrajniwesmahasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit

Enjoy,

Crash

Try to pronounce this and you'll never bother again:

The name of the city of Bangkok in the Thai language:

Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthaniburiromudomrajniwesmahasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit

Enjoy,

Crash

Heck, I had to watch Mary Poppins a dozen times to get Supercalifragilisticexpialidocious down pat. I'm not gonna try that one. I might sprain something important....lmao.

Try this one:

Taumatawhakatangihangak oauauotamateaturipukaka pikimaungahoronukupokaiwhe nua kitanatahu

The M

http://answers.yahoo.com/question/index?qid=20061113221628AAxlNn5
Also known as "Titin"

I find that one isn't hard to pronounce but takes a while...

This one is also hard.
methionylglutaminylarginyltyrosylglutamylserylleuc ylphenylalanylalanylglutaminylleucyll
ysylglutamylarginyllysylglutamylglycylalanylphenyl alanylvalylprolylphenylalanylvalylthre
onylleucylglycylaspartylprolylglycylisoleucylgluta mylglutaminylserylleucyllysylisoleucylas
partylthreonylleucylisoleucylglutamylalanylglycyla lanylaspartylalanylleucylglutamylleuc
ylglycylisoleucylprolylphenylalanylserylaspartylpr olylleucylalanylaspartylglycylprolylthreo
nylisoleucylglutaminylaspfraginylalanylthreonylleu cylarginylalanylphenylalanylalanylala
nylglycylvalylthreonylprolylalanylglutaminylcystei nylphenylalanylglutamylmethionylleuc
ylalanylleucylisoleucylarginylglutaminyllysylhisti dylprolylthreonylisoleucylprolylisoleucylg
lycylleucylleucylmethionyltyrosylalanylasparaginyl leucylvalylphenylalanylasparaginyllysy
lglycylisoleucylaspartylglutamylphenylalanyltyrosy lalanylglutaminylcysteinylglutamyllysyl
valylglycylvalylaspartylserylvalylleucylvalylalany laspartylvalylprolylvalylglutaminylglutam
ylserylalanylprolylphenylalanylarginylglutaminylal anylalanylleucylarginylhistidylasparagi
nylvalylalanylprolylisoleucylphenylalanylisoleucyl cysteinylprolylprolylaspartylalanylaspar
tylaspartylaspartylleucylleucylarginylglutaminylis oleucylalanylseryltyrosylglycylarginylglyc
yltyrosylthreonyltyrosylleucylleucylserylarginylal anylglycylvalylthreonylglycylalanylglutam
ylasparaginylarginylalanylalanylleucylprolylleucyl asparaginylhistidylleucylvalylalanyllysyl
leucyllysylglutamyltyrosylasparaginylalanylalanylp rolylprolylleucylglutaminylglycylphenyl
alanylglycylisoleucylserylalanylprolylaspartylglut aminylvalyllysylalanylalanylisoleucylaspa
rtylalanylglycylalanylalanylglycylalanylisoleucyls erylglycylserylalanylisoleucylvalyllysylisol
eucylisoleucylglutamylglutaminylhistidylasparaginy lisoleucylglutamylprolylglutamyllysylm
ethionylleucylalanylalanylleucyllysylvalylphenylal anylvalylglutaminylprolylmethionyllysyl
alanylalanylthreonylarginylserine.

Now say it ten times fast...

Don't forget the world's largest domain name
http://www.llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch.com/

Man, I'd bust a giblet trying to pronounce any of those....lmao.

Heck, I'd have my tongue wrapped around my eye teeth and I'd never be able to see what I was saying.....

I was sort of getting at more common words that stump people.

I'm gonna have to come back to this one, there are plenty of them but when I try to think of one, nothing happens

I'd like to think I have a pretty decent command of the English language, however my Nan is a constant source of amusement when it comes to pronunciation..

Deodorant= Derodeant
Spaghetti = Pasghetti
Video Recorder = Veedo recorder

I have a few more which I can't think of now, and some I can think of which are too rude for a family forum...  :o  ;D

The guys I work with, for me would say any word in the German language

Matt

[quote]Man, I'd bust a giblet trying to pronounce any of those....lmao.

Heck, I'd have my tongue wrapped around my eye teeth and I'd never be able to see what I was saying.....

I was sort of getting at more common words that stump people.

Man, I'd bust a giblet trying to pronounce any of those....lmao.

I tried to and look what happened...

Man, I'd bust a giblet trying to pronounce any of those....lmao.

I tried to and look what happened...

Wow, looks like that might of hurt.....

Try a chiropractor.... :-/.....maybe the rack-



That might pull you back out straight.....

Most words with ING at the end...its all in the dialect around here, leaves off a lot of G's

[quote]Another I just thought of, but its not so much pronouncing it as much as just combining to words.